Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF364 Rabbit Polyclonal Antibody (FITC)

ZNF364 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

BCA2, ZNF364

UniProt

Q9Y4L5

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human ZNF364

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: PWLELHDTCPVCRKSLNGEDSTRQSQSTEASASNRFSNDSQLHDRWTF

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_055270

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CRISP2 (NM_001142417) AAV Particle
RC227036A1V 250 µL

Human CRISP2 (NM_001142417) AAV Particle

Sign In for Pricing
View Details
PDGFR Alpha mouse Monoclonal Antibody(4G11)
JOT-MCA1010-01 20 µL

PDGFR Alpha mouse Monoclonal Antibody(4G11)

Sign In for Pricing
View Details
PDGFR Alpha mouse Monoclonal Antibody(4G11)
JOT-MCA1010-02 50 μL

PDGFR Alpha mouse Monoclonal Antibody(4G11)

Sign In for Pricing
View Details
PDGFR Alpha mouse Monoclonal Antibody(4G11)
JOT-MCA1010-03 100 µL

PDGFR Alpha mouse Monoclonal Antibody(4G11)

Sign In for Pricing
View Details
SARS-CoV-2 N Protein Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3E1]
TA814434BM 100 µL

SARS-CoV-2 N Protein Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3E1]

Sign In for Pricing
View Details
Ajap1 sgRNA CRISPR Lentivector (Mouse) (Target 3)
K3619804 1.0 µg DNA

Ajap1 sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details