Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HERC3 Rabbit Polyclonal Antibody (FITC)

HERC3 Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

Q15034

Immunogen

The immunogen is a synthetic peptide directed towards the following sequence IPLAQVAAGGAHSFALSLSGAVFGWGMNNAGQLGLSDEKDRESPCHVKLL

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: IPLAQVAAGGAHSFALSLSGAVFGWGMNNAGQLGLSDEKDRESPCHVKLL

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

117 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

NCBI Accession Number

NP_055421

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Actinin Alpha 2 Antibody / Sarcomeric Alpha Actinin / ACTN2
orb640017-01 20 µg

Actinin Alpha 2 Antibody / Sarcomeric Alpha Actinin / ACTN2

Sign In for Pricing
View Details
Actinin Alpha 2 Antibody / Sarcomeric Alpha Actinin / ACTN2
orb640017-02 100 µg

Actinin Alpha 2 Antibody / Sarcomeric Alpha Actinin / ACTN2

Sign In for Pricing
View Details
GAS2 Rabbit pAb, PerCP-Cy7 conjugated
orb2878780 100 µL

GAS2 Rabbit pAb, PerCP-Cy7 conjugated

Sign In for Pricing
View Details
Mouse Angiotensinase A ELISA Kit
MBS727687-01 48 Well

Mouse Angiotensinase A ELISA Kit

Sign In for Pricing
View Details
Mouse Angiotensinase A ELISA Kit
MBS727687-02 96 Well

Mouse Angiotensinase A ELISA Kit

Sign In for Pricing
View Details
Mouse Angiotensinase A ELISA Kit
MBS727687-03 5x 96 Well

Mouse Angiotensinase A ELISA Kit

Sign In for Pricing
View Details