Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HERC3 Rabbit Polyclonal Antibody (HRP)

HERC3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q15034

Immunogen

The immunogen is a synthetic peptide directed towards the following sequence IPLAQVAAGGAHSFALSLSGAVFGWGMNNAGQLGLSDEKDRESPCHVKLL

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: IPLAQVAAGGAHSFALSLSGAVFGWGMNNAGQLGLSDEKDRESPCHVKLL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

117 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

NCBI Accession Number

NP_055421

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Synaptotagmin-14 Polyclonal Antibody
orb1421013 100 µL

Synaptotagmin-14 Polyclonal Antibody

Sign In for Pricing
View Details
Testosterone (FITC)
T2950-14D1-FITC 100 µL

Testosterone (FITC)

Sign In for Pricing
View Details
Sdc3 3'UTR GFP Stable Cell Line
TU168457 1.0 mL

Sdc3 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Lentiviral mouse Tas1r2 shRNA (UAS) - Lentiviral mouse Tas1r2 shRNA (UAS, RFP) plasmid
GTR15269617 1 Vial

Lentiviral mouse Tas1r2 shRNA (UAS) - Lentiviral mouse Tas1r2 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
Lentiviral mouse Togaram2 shRNA (UAS) - Lentiviral mouse Togaram2 shRNA (UAS, iRFP) plasmid
GTR15211240 1 Vial

Lentiviral mouse Togaram2 shRNA (UAS) - Lentiviral mouse Togaram2 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
MRPL16 (39S Ribosomal Protein L16, Mitochondrial, L16mt, MRP-L16, MRPL16) (Biotin) discontinued
302568-Biotin 100 µL

MRPL16 (39S Ribosomal Protein L16, Mitochondrial, L16mt, MRP-L16, MRPL16) (Biotin) discontinued

Sign In for Pricing
View Details