Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBE3C Rabbit Polyclonal Antibody (Biotin)

UBE3C Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

HECTH2

UniProt

Q15386

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human UBE3C

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MFSFEGDFKTRPKVSLGGASRKYSIQRSAFDRCATLSQSGGAFPIANGPN

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

44kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AP3M2 Human shRNA Plasmid Kit (Locus ID 10947)
TR314747 1 Kit

AP3M2 Human shRNA Plasmid Kit (Locus ID 10947)

Sign In for Pricing
View Details
Mouse B-Cell Activation Factor Receptor / BAFFR (TNFRSF13C) ELISA Kit
abx575346-01 96 Tests

Mouse B-Cell Activation Factor Receptor / BAFFR (TNFRSF13C) ELISA Kit

Sign In for Pricing
View Details
Mouse B-Cell Activation Factor Receptor / BAFFR (TNFRSF13C) ELISA Kit
abx575346-02 5x 96 Tests

Mouse B-Cell Activation Factor Receptor / BAFFR (TNFRSF13C) ELISA Kit

Sign In for Pricing
View Details
Mouse B-Cell Activation Factor Receptor / BAFFR (TNFRSF13C) ELISA Kit
abx575346-03 10x 96 Tests

Mouse B-Cell Activation Factor Receptor / BAFFR (TNFRSF13C) ELISA Kit

Sign In for Pricing
View Details
Nesprin3 (SYNE3) Human siRNA Oligo Duplex (Locus ID 161176)
SR325912 1 Kit

Nesprin3 (SYNE3) Human siRNA Oligo Duplex (Locus ID 161176)

Sign In for Pricing
View Details
PAK2 Antibody
3885-01 0.02 mg

PAK2 Antibody

Sign In for Pricing
View Details