Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pja2 Rabbit Polyclonal Antibody (FITC)

Pja2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Neur, AI447901, AL022700, Neurodap1, mKIAA0438

UniProt

Q80U04

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: PAGGYQTITGRRYGRRHAYVSFKPCMTRHERSLGRAGDDYEVLELDDVPK

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

71kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_659108

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FRETS-25His (1 umol)
MBS406206-01 1 Piece

FRETS-25His (1 umol)

Sign In for Pricing
View Details
FRETS-25His (1 umol)
MBS406206-02 5x 1 Piece

FRETS-25His (1 umol)

Sign In for Pricing
View Details
Mcoln3 3'UTR GFP Stable Cell Line
TU262971 1.0 mL

Mcoln3 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
IRAK3 (Interleukin-1 Receptor-associated Kinase 3, IRAK-3, IL-1 Receptor-associated Kinase M, IRAK-M) (PE)
128574-PE 100 µL

IRAK3 (Interleukin-1 Receptor-associated Kinase 3, IRAK-3, IL-1 Receptor-associated Kinase M, IRAK-M) (PE)

Sign In for Pricing
View Details
Rat Kallikrein 1 / KLK1 (NGFG) ELISA Kit
abx156903-01 96 Tests

Rat Kallikrein 1 / KLK1 (NGFG) ELISA Kit

Sign In for Pricing
View Details
Rat Kallikrein 1 / KLK1 (NGFG) ELISA Kit
abx156903-02 5x 96 Tests

Rat Kallikrein 1 / KLK1 (NGFG) ELISA Kit

Sign In for Pricing
View Details