Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ubox5 Rabbit Polyclonal Antibody (Biotin)

Ubox5 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

UI, UIP5, Rnf37, Ube7ip5, Ubce7ip5, 1500010O06Rik, C330018L13Rik

UniProt

Q925F4

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: RVPSDPFTGLAFTPQSQPLPHPSLKARIDRFLLQHSISGCRLLGRAQTPS

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

59kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_542129

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CALCOCO2 (Calcium-binding and Coiled-coil Domain-containing Protein 2, Antigen Nuclear Dot 52kD Protein, Nuclear Domain 10 Protein NDP52, Nuclear Domain 10 Protein 52, Nuclear Dot Protein 52, NDP52) (MaxLight 405) discontinued
124255-ML405 100 µL

CALCOCO2 (Calcium-binding and Coiled-coil Domain-containing Protein 2, Antigen Nuclear Dot 52kD Protein, Nuclear Domain 10 Protein NDP52, Nuclear Domain 10 Protein 52, Nuclear Dot Protein 52, NDP52) (MaxLight 405) discontinued

Sign In for Pricing
View Details
CLC-4 Polyclonal Conjugated Antibody
orb1618908 100 µL

CLC-4 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
Anti-DDX18 Antibody
A10977 100 µg

Anti-DDX18 Antibody

Sign In for Pricing
View Details
SNX25 (Sorting Nexin 25, FLJ23161, MSTP043, SBBI31) (AP)
MBS6394696-01 0.1 mL

SNX25 (Sorting Nexin 25, FLJ23161, MSTP043, SBBI31) (AP)

Sign In for Pricing
View Details
SNX25 (Sorting Nexin 25, FLJ23161, MSTP043, SBBI31) (AP)
MBS6394696-02 5x 0.1 mL

SNX25 (Sorting Nexin 25, FLJ23161, MSTP043, SBBI31) (AP)

Sign In for Pricing
View Details
Porcine Lysophosphatidylcholine Acyltransferase 1 ELISA Kit
MBS043412-01 48 Well

Porcine Lysophosphatidylcholine Acyltransferase 1 ELISA Kit

Sign In for Pricing
View Details