Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NEDD4L Rabbit Polyclonal Antibody (FITC)

NEDD4L Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

RSP5, PVNH7, NEDD4-2, NEDD4.2, hNEDD4-2

UniProt

Q96PU5

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human NEDD4L

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: TVTLSAPLEGAKDSPVRRAVKDTLSNPQSPQPSPYNSPKPQHKVTQSFLP

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

110kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_056092

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Polyclonal Antibody to Kallikrein 13 (KLK13)
TRV-0057593-01 20 µL

Polyclonal Antibody to Kallikrein 13 (KLK13)

Sign In for Pricing
View Details
Polyclonal Antibody to Kallikrein 13 (KLK13)
TRV-0057593-02 100 µL

Polyclonal Antibody to Kallikrein 13 (KLK13)

Sign In for Pricing
View Details
Polyclonal Antibody to Kallikrein 13 (KLK13)
TRV-0057593-03 200 µL

Polyclonal Antibody to Kallikrein 13 (KLK13)

Sign In for Pricing
View Details
Polyclonal Antibody to Kallikrein 13 (KLK13)
TRV-0057593-04 1 mL

Polyclonal Antibody to Kallikrein 13 (KLK13)

Sign In for Pricing
View Details
TRIM42, ID (TRIM42, Tripartite motif-containing protein 42) (MaxLight 405) discontinued
043240-ML405 100 µL

TRIM42, ID (TRIM42, Tripartite motif-containing protein 42) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Shh shRNA (h) Lentiviral Particles
sc-29477-V 200 µL

Shh shRNA (h) Lentiviral Particles

Sign In for Pricing
View Details