Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF294 Rabbit Polyclonal Antibody (HRP)

ZNF294 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

RNF160, ZNF294, C21orf10, C21orf98

UniProt

O94822

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF294

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MGGKNKQRTKGNLRPSNSGRAAELLAKEQGTVPGFIGFGTSQSDLGYVPA

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

200kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_056380

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

External Bypass (for Chillers with M pump)
510-147 1 Each

External Bypass (for Chillers with M pump)

Sign In for Pricing
View Details
Anti-OXGR1/GPR99 Antibody (R2R92)
RHN80002 100 μg

Anti-OXGR1/GPR99 Antibody (R2R92)

Sign In for Pricing
View Details
Zswim3 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K6452005 3x 1.0 µg

Zswim3 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
Α-crystallin B chain (CRYAB) Chicken ELISA Kit
B4095 96 Tests

Α-crystallin B chain (CRYAB) Chicken ELISA Kit

Sign In for Pricing
View Details
Mouse Monoclonal HDHD1A Antibody (OTI7A2) [Alexa Fluor 647]
NBP2-71368AF647 0.1 mL

Mouse Monoclonal HDHD1A Antibody (OTI7A2) [Alexa Fluor 647]

Sign In for Pricing
View Details
Alexa Fluor® 700 mouse IgG1, κ Isotype Control (ICFC)
E16FMCI001K-025IU 25 Tests

Alexa Fluor® 700 mouse IgG1, κ Isotype Control (ICFC)

Sign In for Pricing
View Details