Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF294 Rabbit Polyclonal Antibody (HRP)

ZNF294 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

RNF160, ZNF294, C21orf10, C21orf98

UniProt

O94822

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF294

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MGGKNKQRTKGNLRPSNSGRAAELLAKEQGTVPGFIGFGTSQSDLGYVPA

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

200kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_056380

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal SATB1 Antibody (OTI13D6) [Alexa Fluor 750]
NBP2-73991AF750 0.1 mL

Mouse Monoclonal SATB1 Antibody (OTI13D6) [Alexa Fluor 750]

Sign In for Pricing
View Details
Lcn14 3'UTR Lenti-reporter-Luc Vector
26380084 1.0 µg

Lcn14 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Lentiviral human MMP7 shRNA (UAS) - Lentiviral human MMP7 shRNA (UAS, GFP) (25)
GTR15338255 1 Vial

Lentiviral human MMP7 shRNA (UAS) - Lentiviral human MMP7 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
RPP38 Antibody - C-terminal region : FITC (ARP51891_P050-FITC)
ARP51891_P050-FITC 100 µL

RPP38 Antibody - C-terminal region : FITC (ARP51891_P050-FITC)

Sign In for Pricing
View Details
Human HER2 ELISA Kit
orb219398 96 Tests

Human HER2 ELISA Kit

Sign In for Pricing
View Details
ROCK1 Rabbit mAb
E60M0317 100 µL

ROCK1 Rabbit mAb

Sign In for Pricing
View Details