Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Phf7 Rabbit Polyclonal Antibody (Biotin)

Phf7 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

AI427892, AW555949, 1700006H01Rik, 1700010P14Rik

UniProt

Q9DAG9

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of MOUSE Phf7

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: AIYHRKCIQKYAHTSAKHFFKCPQCNNREEFPQEMLRMGIHIPDRRWRLI

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

29kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PQBP1 (NM_001032381) Human Recombinant Protein
TP304269L 1 mg

PQBP1 (NM_001032381) Human Recombinant Protein

Sign In for Pricing
View Details
Recombinant Mouse CX3CL1/Fractalkine Protein
NBP2-35038-500ug 500 µg

Recombinant Mouse CX3CL1/Fractalkine Protein

Sign In for Pricing
View Details
RRN3 Rabbit Polyclonal Antibody
orb2302634 100 µg

RRN3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
LOC499715 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K6006705 3x 1.0 µg

LOC499715 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
ARNT Detection Antibody
OAOA21959-50UG 50 µg

ARNT Detection Antibody

Sign In for Pricing
View Details
Galectin 1 Lgals1 Rabbit Polyclonal Antibody
orb546285 100 µg

Galectin 1 Lgals1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details