Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MARCH2 Rabbit Polyclonal Antibody (HRP)

MARCH2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Marc, March2, MARCH-II, 9530046H09Rik

UniProt

Q8CA25

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LAAISGWLCLRGAQDHLRLHSRLEAVGLIALTIALFTIYVLWTLVSFRYH

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

32kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_663461

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCDC158 (C-term) Rabbit Polyclonal Antibody
AP50771PU-N 400 µL

CCDC158 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SERBP1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2E11]
TA800699AM 100 µL

SERBP1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2E11]

Sign In for Pricing
View Details
High Temperature Foaming Characteristics Tester BPTL-217
BPTL-217 1 Unit

High Temperature Foaming Characteristics Tester BPTL-217

Sign In for Pricing
View Details
Recombinant Mouse Mmp8 Protein (His Tag)
PDMM100221-01 20 µg

Recombinant Mouse Mmp8 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse Mmp8 Protein (His Tag)
PDMM100221-02 100 µg

Recombinant Mouse Mmp8 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse Mmp8 Protein (His Tag)
PDMM100221-03 500 µg

Recombinant Mouse Mmp8 Protein (His Tag)

Sign In for Pricing
View Details