Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bfar Rabbit Polyclonal Antibody (FITC)

Bfar Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Bar, RNF, Rnf47, AI666707, AW107665, 3110001I22, 3010001A07Rik, 3110001I22Rik

UniProt

Q8R079

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: NDVVQSLAAFQKYGNDQNPLAPSTGRVNPQRGGGFFSGVLTALTGVAVIL

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

53kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_080252

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

14-3-3 zeta/delta/YWHAZ/14 Mouse Monoclonal Antibody (Fluoro594)
orb3085412 100 µg

14-3-3 zeta/delta/YWHAZ/14 Mouse Monoclonal Antibody (Fluoro594)

Sign In for Pricing
View Details
Dog VCAM1/Vascular cell adhesion protein 1 ELISA Kit
E45K00823 96 Tests

Dog VCAM1/Vascular cell adhesion protein 1 ELISA Kit

Sign In for Pricing
View Details
Recombinant Bacillus anthracis UPF0176 protein BAA_1948 (BAA_1948)
MBS1040983-01 0.02 mg (E-Coli)

Recombinant Bacillus anthracis UPF0176 protein BAA_1948 (BAA_1948)

Sign In for Pricing
View Details
Recombinant Bacillus anthracis UPF0176 protein BAA_1948 (BAA_1948)
MBS1040983-02 0.02 mg (Yeast)

Recombinant Bacillus anthracis UPF0176 protein BAA_1948 (BAA_1948)

Sign In for Pricing
View Details
Recombinant Bacillus anthracis UPF0176 protein BAA_1948 (BAA_1948)
MBS1040983-03 0.1 mg (E-Coli)

Recombinant Bacillus anthracis UPF0176 protein BAA_1948 (BAA_1948)

Sign In for Pricing
View Details
Recombinant Bacillus anthracis UPF0176 protein BAA_1948 (BAA_1948)
MBS1040983-04 0.1 mg (Yeast)

Recombinant Bacillus anthracis UPF0176 protein BAA_1948 (BAA_1948)

Sign In for Pricing
View Details