Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HERC3 Rabbit Polyclonal Antibody (FITC)

HERC3 Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

Q15034

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human HERC3

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LHFPLALYKKLLNVKPGLEDLKELSPTEGRSLQELLDYPGEDVEETFCLN

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

54kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001258531.1

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Galectin-1 (LGALS1) ELISA Kit
AE35699HU-01 48 Tests

Human Galectin-1 (LGALS1) ELISA Kit

Sign In for Pricing
View Details
Human Galectin-1 (LGALS1) ELISA Kit
AE35699HU-02 96 Tests

Human Galectin-1 (LGALS1) ELISA Kit

Sign In for Pricing
View Details
Rat Neural cell adhesion molecule 1 (NCAM1) ELISA Kit
AE31621RA-01 48 Tests

Rat Neural cell adhesion molecule 1 (NCAM1) ELISA Kit

Sign In for Pricing
View Details
Rat Neural cell adhesion molecule 1 (NCAM1) ELISA Kit
AE31621RA-02 96 Tests

Rat Neural cell adhesion molecule 1 (NCAM1) ELISA Kit

Sign In for Pricing
View Details
MMP20, CT (MMP20, Matrix metalloproteinase-20, Enamel metalloproteinase, Enamelysin) (MaxLight 650)
MBS6321424-01 0.1 mL

MMP20, CT (MMP20, Matrix metalloproteinase-20, Enamel metalloproteinase, Enamelysin) (MaxLight 650)

Sign In for Pricing
View Details
MMP20, CT (MMP20, Matrix metalloproteinase-20, Enamel metalloproteinase, Enamelysin) (MaxLight 650)
MBS6321424-02 5x 0.1 mL

MMP20, CT (MMP20, Matrix metalloproteinase-20, Enamel metalloproteinase, Enamelysin) (MaxLight 650)

Sign In for Pricing
View Details