Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C14orf130 Rabbit Polyclonal Antibody (FITC)

C14orf130 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

LICAS, C14orf130

UniProt

Q8N806

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human C14orf130

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: DRSDPLMDTLSSMNRVQQVELICEYNDLKTELKDYLKRFADEGTVVKRED

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

30kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

AAH15046

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Biotin HPDP
TRC-B390750-5MG 5 mg

Biotin HPDP

Sign In for Pricing
View Details
Human ERGIC1 activation kit by CRISPRa
GA111454 1 Kit

Human ERGIC1 activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant Mouse CREG/CREG1 Protein (Fc Tag)
PKSM040377 50 µg

Recombinant Mouse CREG/CREG1 Protein (Fc Tag)

Sign In for Pricing
View Details
Amino terminal enhancer of split (AES) (NM_001130) Human Over-expression Lysate
LC420115 20 µg

Amino terminal enhancer of split (AES) (NM_001130) Human Over-expression Lysate

Sign In for Pricing
View Details
FOXP3 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI6B10]
TA810610BM 100 µL

FOXP3 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI6B10]

Sign In for Pricing
View Details
PD-L1 / PDCD1LG1 / CD274 / B7-H1 (Cancer Immunotherapy Target) (PDL1/2742), CF640R conjugate, 0.1mg/mL
BNC402742-100 1x 100 µL

PD-L1 / PDCD1LG1 / CD274 / B7-H1 (Cancer Immunotherapy Target) (PDL1/2742), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details