Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MSL2L1 Rabbit Polyclonal Antibody (Biotin)

MSL2L1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

MSL-2, MSL2L1, RNF184

UniProt

Q9HCI7

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human MSL2L1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: NPVNATALYISASRLVLNYDPGDPKAFTEINRLLPYFRQSLSCCVCGHLL

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

62kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_060603

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse mmu-miR-6913-3p miRNA Antagomir
abx889128-01 10 nmol

Mouse mmu-miR-6913-3p miRNA Antagomir

Sign In for Pricing
View Details
Mouse mmu-miR-6913-3p miRNA Antagomir
abx889128-02 20 nmol

Mouse mmu-miR-6913-3p miRNA Antagomir

Sign In for Pricing
View Details
Rat Uterine Smooth Muscle Cells-Immortalized by SV40T Antigens
CC7F236 1x 10^6 Cells/Vial

Rat Uterine Smooth Muscle Cells-Immortalized by SV40T Antigens

Sign In for Pricing
View Details
(2R,4S) -5- (Biphenyl-4-yl) -4- (2,5-dioxopyrrolidin-1-yl) -2-methylpentanoic acid ethyl ester (Standard)
HY-Z0067R 1 Each

(2R,4S) -5- (Biphenyl-4-yl) -4- (2,5-dioxopyrrolidin-1-yl) -2-methylpentanoic acid ethyl ester (Standard)

Sign In for Pricing
View Details
Stabilin 1 (Stabilin-1, STAB1, STAB-1, Fasciclin, EGF-like, Laminin-type EGF-like and Link Domain-containing Scavenger Receptor 1, FEEL1, FEEL-1, FELE-1, CLEVER-1, FEX1, KIAA0246, MS-1 Antigen)
133908 100 µg

Stabilin 1 (Stabilin-1, STAB1, STAB-1, Fasciclin, EGF-like, Laminin-type EGF-like and Link Domain-containing Scavenger Receptor 1, FEEL1, FEEL-1, FELE-1, CLEVER-1, FEX1, KIAA0246, MS-1 Antigen)

Sign In for Pricing
View Details
TPR antibody - C-terminal region
MBS3215077-01 0.1 mL

TPR antibody - C-terminal region

Sign In for Pricing
View Details