Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MSL2L1 Rabbit Polyclonal Antibody (HRP)

MSL2L1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MSL-2, MSL2L1, RNF184

UniProt

Q9HCI7

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human MSL2L1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: NPVNATALYISASRLVLNYDPGDPKAFTEINRLLPYFRQSLSCCVCGHLL

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

62kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_060603

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FOXA1 / HNF3A (rFOXA1/1515), CF568 conjugate, 0.1mg/mL
BNC682305-100 1x 100 µL

FOXA1 / HNF3A (rFOXA1/1515), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PDGF Receptor alpha (PDGFRA) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5A3]
TA807644BM 100 µL

PDGF Receptor alpha (PDGFRA) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5A3]

Sign In for Pricing
View Details
Tissue Total RNA, Lymphoid tissue
CR561815 5 µg

Tissue Total RNA, Lymphoid tissue

Sign In for Pricing
View Details
Wnt10b Mouse Gene Knockout Kit (CRISPR)
KN519447 1 Kit

Wnt10b Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
BOB.1 (B-Cell Marker) (BOB1/2422), 0.2mg/mL
BNUB2422-500 1x 500 µL

BOB.1 (B-Cell Marker) (BOB1/2422), 0.2mg/mL

Sign In for Pricing
View Details
FAM167B Human Gene Knockout Kit (CRISPR)
KN402563 1 Kit

FAM167B Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details