Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IRF1 Rabbit Polyclonal Antibody (HRP)

IRF1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MAR, IRF-1

UniProt

P10914

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human IRF1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: NFQVSPMPSTSEATTDEDEEGKLPEDIMKLLEQSEWQPTNVDGKGYLLNE

Field of Research

Infectious Disease & Virology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_002189

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Guinea pig Xeroderma Pigmentosum, Complementation Group D ELISA Kit
MBS755957-01 48 Well

Guinea pig Xeroderma Pigmentosum, Complementation Group D ELISA Kit

Sign In for Pricing
View Details
Guinea pig Xeroderma Pigmentosum, Complementation Group D ELISA Kit
MBS755957-02 96 Well

Guinea pig Xeroderma Pigmentosum, Complementation Group D ELISA Kit

Sign In for Pricing
View Details
Guinea pig Xeroderma Pigmentosum, Complementation Group D ELISA Kit
MBS755957-03 5x 96 Well

Guinea pig Xeroderma Pigmentosum, Complementation Group D ELISA Kit

Sign In for Pricing
View Details
Guinea pig Xeroderma Pigmentosum, Complementation Group D ELISA Kit
MBS755957-04 10x 96 Well

Guinea pig Xeroderma Pigmentosum, Complementation Group D ELISA Kit

Sign In for Pricing
View Details
Mouse Afap1l1 (NM_178928) AAV Particle
MR223658A1V 250 µL

Mouse Afap1l1 (NM_178928) AAV Particle

Sign In for Pricing
View Details
AmiF Recombinant Protein
OPCA03145-1MG 1 mg

AmiF Recombinant Protein

Sign In for Pricing
View Details