Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHFR Rabbit Polyclonal Antibody (Biotin)

CHFR Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

RNF116, RNF196

UniProt

Q96EP1

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human CHFR

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: REWTIGRRRGCDLSFPSNKLVSGDHCRIVVDEKSGQVTLEDTSTSGTVIN

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

69kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_060693

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAP1ALC3, NT (LC3, APG8A, MAP1LC3B, Microtubule-associated proteins 1A/1B light chain 3B, Autophagy-related protein LC3 B, Autophagy-related ubiquitin-like modifier LC3 B, MAP1 light chain 3-like protein 2, MAP1A/MAP1B light chain 3 B, Microtubule-associated protein 1 light chain 3 beta)
038096 200 µL

MAP1ALC3, NT (LC3, APG8A, MAP1LC3B, Microtubule-associated proteins 1A/1B light chain 3B, Autophagy-related protein LC3 B, Autophagy-related ubiquitin-like modifier LC3 B, MAP1 light chain 3-like protein 2, MAP1A/MAP1B light chain 3 B, Microtubule-associated protein 1 light chain 3 beta)

Sign In for Pricing
View Details
Serpina10 sgRNA CRISPR Lentivector set (Rat)
K7004901 3x 1.0 µg

Serpina10 sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details
Anti-p53R2/RRM2B Antibody Picoband®, Dylight594 Conjugate
PA2053-Dylight594 100 µg

Anti-p53R2/RRM2B Antibody Picoband®, Dylight594 Conjugate

Sign In for Pricing
View Details
Recombinant Thermosynechococcus elongatus Acetate kinase (ackA)
MBS1338286-01 0.02 mg (E-Coli)

Recombinant Thermosynechococcus elongatus Acetate kinase (ackA)

Sign In for Pricing
View Details
Recombinant Thermosynechococcus elongatus Acetate kinase (ackA)
MBS1338286-02 0.02 mg (Yeast)

Recombinant Thermosynechococcus elongatus Acetate kinase (ackA)

Sign In for Pricing
View Details
Recombinant Thermosynechococcus elongatus Acetate kinase (ackA)
MBS1338286-03 0.1 mg (E-Coli)

Recombinant Thermosynechococcus elongatus Acetate kinase (ackA)

Sign In for Pricing
View Details