Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RNF121 Rabbit Polyclonal Antibody (FITC)

RNF121 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

FLJ11099

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human RNF121

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: WWRFLVIWILFSAVTAFVTFRATRKPLVQTTPRLVYKWFLLIYKISYATG

Field of Research

Cell Biology

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

32kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_919435

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NPRC Recombinant Antibody, AbBy Fluor™ 350 Conjugated
bsm-61782R-BF350 100 µL

NPRC Recombinant Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details
Human E1A Binding Protein P300 ELISA Kit
MBS071685-01 48 Well

Human E1A Binding Protein P300 ELISA Kit

Sign In for Pricing
View Details
Human E1A Binding Protein P300 ELISA Kit
MBS071685-02 96 Well

Human E1A Binding Protein P300 ELISA Kit

Sign In for Pricing
View Details
Human E1A Binding Protein P300 ELISA Kit
MBS071685-03 5x 96 Well

Human E1A Binding Protein P300 ELISA Kit

Sign In for Pricing
View Details
Human E1A Binding Protein P300 ELISA Kit
MBS071685-04 10x 96 Well

Human E1A Binding Protein P300 ELISA Kit

Sign In for Pricing
View Details
AIG1 Human shRNA Lentiviral Particle (Locus ID 51390)
TL306784V 500 µL Each

AIG1 Human shRNA Lentiviral Particle (Locus ID 51390)

Sign In for Pricing
View Details