Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RNF121 Rabbit Polyclonal Antibody (FITC)

RNF121 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

FLJ11099

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human RNF121

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: WWRFLVIWILFSAVTAFVTFRATRKPLVQTTPRLVYKWFLLIYKISYATG

Field of Research

Cell Biology

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

32kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_919435

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMED9 Polyclonal Antibody
A53113-020 20 µL

TMED9 Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human S-phase kinase-associated protein 2 (SKP2)
RPC22964-01 20 µg

Recombinant Human S-phase kinase-associated protein 2 (SKP2)

Sign In for Pricing
View Details
Recombinant Human S-phase kinase-associated protein 2 (SKP2)
RPC22964-02 100 µg

Recombinant Human S-phase kinase-associated protein 2 (SKP2)

Sign In for Pricing
View Details
Recombinant Human S-phase kinase-associated protein 2 (SKP2)
RPC22964-03 1 mg

Recombinant Human S-phase kinase-associated protein 2 (SKP2)

Sign In for Pricing
View Details
RBJ (E-2) PE
sc-390736 PE 200 µg/mL

RBJ (E-2) PE

Sign In for Pricing
View Details
TWEAK (TNFSF12) (NM_003809) Human Over-expression Lysate
LY418410 100 µg

TWEAK (TNFSF12) (NM_003809) Human Over-expression Lysate

Sign In for Pricing
View Details