Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RNF121 Rabbit Polyclonal Antibody (HRP)

RNF121 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

FLJ11099

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human RNF121

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: WWRFLVIWILFSAVTAFVTFRATRKPLVQTTPRLVYKWFLLIYKISYATG

Field of Research

Cell Biology

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

32kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_919435

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DCTN3 (NM_024348) Human Tagged Lenti ORF Clone
RC201253L2 10 µg

DCTN3 (NM_024348) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Synaptotagmin 4 Antibody
orb1321028 100 µL

Synaptotagmin 4 Antibody

Sign In for Pricing
View Details
SPPL2B Rabbit pAb
E47R11682 100 µL

SPPL2B Rabbit pAb

Sign In for Pricing
View Details
Rabbit Polyclonal p66 alpha Antibody
NB100-56643 0.2 mL

Rabbit Polyclonal p66 alpha Antibody

Sign In for Pricing
View Details
GPx-5 (D-3) Alexa Fluor® 594
sc-390092 AF594 200 µg/mL

GPx-5 (D-3) Alexa Fluor® 594

Sign In for Pricing
View Details
Translocon-associated Protein Subunit alpha, NT (SSR1, TRAP-alpha, Signal Sequence Receptor Subunit alpha, SSR-alpha, SSR1, TRAPA, PSEC0262)
MBS627112-01 0.2 mL

Translocon-associated Protein Subunit alpha, NT (SSR1, TRAP-alpha, Signal Sequence Receptor Subunit alpha, SSR-alpha, SSR1, TRAPA, PSEC0262)

Sign In for Pricing
View Details