Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RNF121 Rabbit Polyclonal Antibody (HRP)

RNF121 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

FLJ11099

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human RNF121

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: WWRFLVIWILFSAVTAFVTFRATRKPLVQTTPRLVYKWFLLIYKISYATG

Field of Research

Cell Biology

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

32kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_919435

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC25A1 Rabbit Polyclonal Antibody
E10G01804 100 µL

SLC25A1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
NLRP7 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated
bs-6866R-BF488 100 µL

NLRP7 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details
Interleukin 18 (IL18) Magnetic Fluorescence Assay Kit
MBS2154591-01 96 Tests

Interleukin 18 (IL18) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Interleukin 18 (IL18) Magnetic Fluorescence Assay Kit
MBS2154591-02 5x 96 Tests

Interleukin 18 (IL18) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Interleukin 18 (IL18) Magnetic Fluorescence Assay Kit
MBS2154591-03 10x 96 Tests

Interleukin 18 (IL18) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Ethyl 4-Biphenylacetate
TRC-E900208-50MG 50 mg

Ethyl 4-Biphenylacetate

Sign In for Pricing
View Details