Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Trim36 Rabbit Polyclonal Antibody (FITC)

Trim36 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Trim36

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: ESTKSCMDCSASYCNECFKIYHPWGTVKAQHEYVGPTTNFRPKILMCPEH

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

83kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001099617

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal AMICA/JAML Antibody (401901) [HRP]
FAB34491H 0.1 mL

Mouse Monoclonal AMICA/JAML Antibody (401901) [HRP]

Sign In for Pricing
View Details
Recombinant NAD (P) H-quinone oxidoreductase subunit 3, chloroplastic (ndhC)
orb2933177-01 20 µg

Recombinant NAD (P) H-quinone oxidoreductase subunit 3, chloroplastic (ndhC)

Sign In for Pricing
View Details
Recombinant NAD (P) H-quinone oxidoreductase subunit 3, chloroplastic (ndhC)
orb2933177-02 100 µg

Recombinant NAD (P) H-quinone oxidoreductase subunit 3, chloroplastic (ndhC)

Sign In for Pricing
View Details
Mouse Monoclonal ACBD7 Antibody (08) [Alexa Fluor 405]
NBP3-06599AF405 0.1 mL

Mouse Monoclonal ACBD7 Antibody (08) [Alexa Fluor 405]

Sign In for Pricing
View Details
Asb18 (NM_001108231) Rat Untagged Clone
RN215696 10 µg

Asb18 (NM_001108231) Rat Untagged Clone

Sign In for Pricing
View Details
EBP CRISPR All-in-one AAV vector set (with saCas9)(Human)
18874151 3x 1.0 µg DNA

EBP CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details