Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAD18 Rabbit Polyclonal Antibody (HRP)

RAD18 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

RNF73

UniProt

Q9NS91

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human RAD18

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LSDRDLKKKLKEHGLSIQGNKQQLIKRHQEFVHMYNAQCDALHPKSAAEI

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

56kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_064550

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCCA (Center) Rabbit Polyclonal Antibody
AP53192PU-N 400 µL

PCCA (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Stk16 Mouse Gene Knockout Kit (CRISPR)
KN516870 1 Kit

Stk16 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Ghrelin Recombinant Rabbit Monoclonal Antibody [PSH08-77]
HA723029 100 µL

Ghrelin Recombinant Rabbit Monoclonal Antibody [PSH08-77]

Sign In for Pricing
View Details
Cytochrome P450 1A2 (CYP1A2) (NM_000761) Human Recombinant Protein
TP321636 20 µg

Cytochrome P450 1A2 (CYP1A2) (NM_000761) Human Recombinant Protein

Sign In for Pricing
View Details
GnRH-Receptor / LH-RH Receptor (GNRHR/2982R), CF740 conjugate, 0.1mg/mL
BNC742982-100 1x 100 µL

GnRH-Receptor / LH-RH Receptor (GNRHR/2982R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human EGF Recombinant Rabbit Monoclonal Antibody [PSH02-20] - BSA and Azide free (Detector)
HA721783 100 µL

Human EGF Recombinant Rabbit Monoclonal Antibody [PSH02-20] - BSA and Azide free (Detector)

Sign In for Pricing
View Details