Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HERC4 Rabbit Polyclonal Antibody (Biotin)

HERC4 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

DKFZP564G092, KIAA1593

UniProt

Q5GLZ8

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human HERC4

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LVIQSTGGGEEYLPVSHTCFNLLDLPKYTEKETLRSKLIQAIDHNEGFSL

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

118kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast

Tested Applications

IHC, WB

NCBI Accession Number

NP_071362

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VTN Antibody
orb252551 100 µL

VTN Antibody

Sign In for Pricing
View Details
KIT, phosphorylated (Y547) (KIT, SCFR, Mast/stem cell growth factor receptor Kit, Piebald trait protein, Proto-oncogene c-Kit, Tyrosine-protein kinase Kit, p145 c-kit, v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene homolog, CD117) (MaxLight 550) discontinued
037505-ML550 100 µL

KIT, phosphorylated (Y547) (KIT, SCFR, Mast/stem cell growth factor receptor Kit, Piebald trait protein, Proto-oncogene c-Kit, Tyrosine-protein kinase Kit, p145 c-kit, v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene homolog, CD117) (MaxLight 550) discontinued

Sign In for Pricing
View Details
Recombinant Rat Ephrin-A1
MBS9422272-01 0.02 mg

Recombinant Rat Ephrin-A1

Sign In for Pricing
View Details
Recombinant Rat Ephrin-A1
MBS9422272-02 0.1 mg

Recombinant Rat Ephrin-A1

Sign In for Pricing
View Details
Recombinant Rat Ephrin-A1
MBS9422272-03 1 mg

Recombinant Rat Ephrin-A1

Sign In for Pricing
View Details
Recombinant Rat Ephrin-A1
MBS9422272-04 5x 1 mg

Recombinant Rat Ephrin-A1

Sign In for Pricing
View Details