Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C1orf166 Rabbit Polyclonal Antibody (HRP)

C1orf166 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

GIDE, MAPL, MULAN, RNF218, C1orf166

UniProt

Q969V5

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human C1orf166

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KPLDSVDLGLETVYEKFHPSIQSFTDVIGHYISGERPKGIQETEEMLKVG

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

40kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_078820

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Thrombomodulin / CD141 (Endothelial Cell Marker) (rTHBD/1591), CF568 conjugate, 0.1mg/mL
BNC682332-100 1x 100 µL

Thrombomodulin / CD141 (Endothelial Cell Marker) (rTHBD/1591), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MiTF (Microphthalmia Transcription Factor) (C5/D5), CF647 conjugate, 0.1mg/mL
BNC470892-100 1x 100 µL

MiTF (Microphthalmia Transcription Factor) (C5/D5), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CASKIN2 (NM_001142643) Human Over-expression Lysate
LC428227 20 µg

CASKIN2 (NM_001142643) Human Over-expression Lysate

Sign In for Pricing
View Details
Glypican-3 (1G12), 0.2mg/mL
BNUB0862-500 1x 500 µL

Glypican-3 (1G12), 0.2mg/mL

Sign In for Pricing
View Details
CAVIN1 (N-term) Rabbit Polyclonal Antibody
AP14066PU-N 400 µL

CAVIN1 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human TIF1 gamma (TRIM33) activation kit by CRISPRa
GA109889 1 Kit

Human TIF1 gamma (TRIM33) activation kit by CRISPRa

Sign In for Pricing
View Details