Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C1orf166 Rabbit Polyclonal Antibody (HRP)

C1orf166 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

GIDE, MAPL, MULAN, RNF218, C1orf166

UniProt

Q969V5

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human C1orf166

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GMQYYLSSQDFDSLLQRQESSVRLWKVLALVFGFATCATLFFILRKQYLQ

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

40kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_078820

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tceal6 Mouse Gene Knockout Kit (CRISPR)
KN517308 1 Kit

Tceal6 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Gramd3 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K3556703 1.0 µg DNA

Gramd3 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Ornipressin (POR-8) 10mg
A18221-10 10 mg

Ornipressin (POR-8) 10mg

Sign In for Pricing
View Details
PEX3 antibody
70R-1040 100 ug

PEX3 antibody

Sign In for Pricing
View Details
nod3l sgRNA CRISPR Lentivector set (Rat)
K6657501 3x 1.0 µg

nod3l sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details
Recombinant Agrobacterium tumefaciens Cobyrinic acid A,C-diamide synthase (cobB)
MBS1361985-01 0.02 mg (E-Coli)

Recombinant Agrobacterium tumefaciens Cobyrinic acid A,C-diamide synthase (cobB)

Sign In for Pricing
View Details