Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C1orf166 Rabbit Polyclonal Antibody (HRP)

C1orf166 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

GIDE, MAPL, MULAN, RNF218, C1orf166

UniProt

Q969V5

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human C1orf166

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GMQYYLSSQDFDSLLQRQESSVRLWKVLALVFGFATCATLFFILRKQYLQ

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

40kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_078820

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sheep Fibrillarin ELISA Kit
MBS748388-01 48 Well

Sheep Fibrillarin ELISA Kit

Sign In for Pricing
View Details
Sheep Fibrillarin ELISA Kit
MBS748388-02 96 Well

Sheep Fibrillarin ELISA Kit

Sign In for Pricing
View Details
Sheep Fibrillarin ELISA Kit
MBS748388-03 5x 96 Well

Sheep Fibrillarin ELISA Kit

Sign In for Pricing
View Details
Sheep Fibrillarin ELISA Kit
MBS748388-04 10x 96 Well

Sheep Fibrillarin ELISA Kit

Sign In for Pricing
View Details
Rabbit Polyclonal SUMO4 Antibody [Janelia Fluor 646]
NBP2-97570JF646 0.1 mL

Rabbit Polyclonal SUMO4 Antibody [Janelia Fluor 646]

Sign In for Pricing
View Details
MYL6, ID (MYL6, Myosin light polypeptide 6, 17kD myosin light chain, Myosin light chain 3, Myosin light chain alkali 3, Smooth muscle and nonmuscle myosin light chain alkali 6) (MaxLight 550)
MBS6323348-01 0.1 mL

MYL6, ID (MYL6, Myosin light polypeptide 6, 17kD myosin light chain, Myosin light chain 3, Myosin light chain alkali 3, Smooth muscle and nonmuscle myosin light chain alkali 6) (MaxLight 550)

Sign In for Pricing
View Details