Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LONRF3 Rabbit Polyclonal Antibody (FITC)

LONRF3 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

RNF127

UniProt

Q496Y0

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human LONRF3

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LEIRNVQFFADGRSVVDSIGKRRFRVLHQSQRDGYNTADIEYIEDQKVQG

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

84kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001027026

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human SGTA AssayLite™ Antibody (RPE Conjugate)
33143-05151 5 x 30 µg

Human SGTA AssayLite™ Antibody (RPE Conjugate)

Sign In for Pricing
View Details
RICK, CT (Receptor-interacting Serine/Threonine Protein Kinase 2, RIP-like Interacting CLARP Kinase, Receptor-interacting Protein 2, RIP-2, CARD-containing Interleukin-1 beta Converting Enzyme Associated Kinase, CARD-containing IL-1 beta ICE-kinase, RIPK2
MBS6497780-01 0.1 mL

RICK, CT (Receptor-interacting Serine/Threonine Protein Kinase 2, RIP-like Interacting CLARP Kinase, Receptor-interacting Protein 2, RIP-2, CARD-containing Interleukin-1 beta Converting Enzyme Associated Kinase, CARD-containing IL-1 beta ICE-kinase, RIPK2

Sign In for Pricing
View Details
RICK, CT (Receptor-interacting Serine/Threonine Protein Kinase 2, RIP-like Interacting CLARP Kinase, Receptor-interacting Protein 2, RIP-2, CARD-containing Interleukin-1 beta Converting Enzyme Associated Kinase, CARD-containing IL-1 beta ICE-kinase, RIPK2
MBS6497780-02 5x 0.1 mL

RICK, CT (Receptor-interacting Serine/Threonine Protein Kinase 2, RIP-like Interacting CLARP Kinase, Receptor-interacting Protein 2, RIP-2, CARD-containing Interleukin-1 beta Converting Enzyme Associated Kinase, CARD-containing IL-1 beta ICE-kinase, RIPK2

Sign In for Pricing
View Details
AMK (hydrochloride)
MBS5797367 Inquire

AMK (hydrochloride)

Sign In for Pricing
View Details
Rabbit Polyclonal PLBD2 Antibody [DyLight 405]
NBP3-06057V 0.1 mL

Rabbit Polyclonal PLBD2 Antibody [DyLight 405]

Sign In for Pricing
View Details
Mouse PI3K (Phosphotylinosital 3 kinase) ELISA Kit
EK248001 96 Well

Mouse PI3K (Phosphotylinosital 3 kinase) ELISA Kit

Sign In for Pricing
View Details