Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rnf122 Rabbit Polyclonal Antibody (HRP)

Rnf122 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

1110063C11Rik

UniProt

Q8BP31

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SLIFCCYFISKLRNQAQSERYGYKEVVLKGDAKKLQLYGTCAVCLEDFKG

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

17kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_780345

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Thioredoxin ELISA Kit PicoKine®, Carrier-free
EK1254-carrier-free 96 Well With Removable Strips

Human Thioredoxin ELISA Kit PicoKine®, Carrier-free

Sign In for Pricing
View Details
PTPN2 (Tyrosine-Protein Phosphatase Non-Receptor Type 2, Protein Tyrosine Phosphatase, Non-Receptor Type 2)
489746 100 µL

PTPN2 (Tyrosine-Protein Phosphatase Non-Receptor Type 2, Protein Tyrosine Phosphatase, Non-Receptor Type 2)

Sign In for Pricing
View Details
Lentiviral human ATF2 shRNA (UAS) - Lentiviral human ATF2 shRNA (UAS, RFP) (100)
GTR15116844 1 Vial

Lentiviral human ATF2 shRNA (UAS) - Lentiviral human ATF2 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
SLC26A10 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
44065111 3x 1.0 µg

SLC26A10 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
CPNE6 Recombinant Protein (Mouse)
RP125783 100 µg

CPNE6 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana UDP-glycosyltransferase 73B3 (UGT73B3)
MBS1383231-01 0.02 mg (E-Coli)

Recombinant Arabidopsis thaliana UDP-glycosyltransferase 73B3 (UGT73B3)

Sign In for Pricing
View Details