Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fbxo11 Rabbit Polyclonal Antibody (FITC)

Fbxo11 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Jf, C80048

UniProt

E9QP06

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: RRNKIHDGRDGGICIFNGGRGLLEENDIFRNAQAGVLISTNSHPVLRKNR

Field of Research

Cancer Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

104kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001074503

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Biotin-PEG-OH (MW 10000)
HY-147205D 1 Each

Biotin-PEG-OH (MW 10000)

Sign In for Pricing
View Details
Duck A Disintegrin and Metalloprotease 22 ELISA Kit
MBS063425 Inquire

Duck A Disintegrin and Metalloprotease 22 ELISA Kit

Sign In for Pricing
View Details
ELISA Kit For Oncoprotein-induced transcript 3 protein
E1729h 96 Tests

ELISA Kit For Oncoprotein-induced transcript 3 protein

Sign In for Pricing
View Details
SOCS-4 siRNA (h)
sc-63050 10 µM

SOCS-4 siRNA (h)

Sign In for Pricing
View Details
Fish Mitochondrial Inner Membrane Protease ATP23 Homolog (XRCC6BP1) ELISA Kit
MBS9924272 Inquire

Fish Mitochondrial Inner Membrane Protease ATP23 Homolog (XRCC6BP1) ELISA Kit

Sign In for Pricing
View Details
Bovine ANXA1 / Annexin A1 Recombinant Protein
R0333b 1 Each

Bovine ANXA1 / Annexin A1 Recombinant Protein

Sign In for Pricing
View Details