Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RNF170 Rabbit Polyclonal Antibody (Biotin)

RNF170 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

ADSA, SNAX1

UniProt

Q96K19

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human RNF170

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: FYLISPLDFVPEALFGILGFLDDFFVIFLLLIYISIMYREVITQRLTR

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

30kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_112216

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UQCRFS1, CT (UQCRFS1, Cytochrome b-c1 complex subunit Rieske, mitochondrial, Complex III subunit 5, Cytochrome b-c1 complex subunit 5, Rieske iron-sulfur protein, Ubiquinol-cytochrome c reductase iron-sulfur subunit, Cytochrome b-c1 complex subunit 11, Co
MBS6361721-01 0.2 mL

UQCRFS1, CT (UQCRFS1, Cytochrome b-c1 complex subunit Rieske, mitochondrial, Complex III subunit 5, Cytochrome b-c1 complex subunit 5, Rieske iron-sulfur protein, Ubiquinol-cytochrome c reductase iron-sulfur subunit, Cytochrome b-c1 complex subunit 11, Co

Sign In for Pricing
View Details
UQCRFS1, CT (UQCRFS1, Cytochrome b-c1 complex subunit Rieske, mitochondrial, Complex III subunit 5, Cytochrome b-c1 complex subunit 5, Rieske iron-sulfur protein, Ubiquinol-cytochrome c reductase iron-sulfur subunit, Cytochrome b-c1 complex subunit 11, Co
MBS6361721-02 5x 0.2 mL

UQCRFS1, CT (UQCRFS1, Cytochrome b-c1 complex subunit Rieske, mitochondrial, Complex III subunit 5, Cytochrome b-c1 complex subunit 5, Rieske iron-sulfur protein, Ubiquinol-cytochrome c reductase iron-sulfur subunit, Cytochrome b-c1 complex subunit 11, Co

Sign In for Pricing
View Details
Gp100 (570-579)
CCP2389-01 1 mg

Gp100 (570-579)

Sign In for Pricing
View Details
Gp100 (570-579)
CCP2389-02 5 mg

Gp100 (570-579)

Sign In for Pricing
View Details
Gp100 (570-579)
CCP2389-03 10 mg

Gp100 (570-579)

Sign In for Pricing
View Details
POMC Blocking Peptide
MBS9622886-01 1 mg

POMC Blocking Peptide

Sign In for Pricing
View Details