Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PCGF6 Rabbit Polyclonal Antibody (HRP)

PCGF6 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MBLR, RNF134

UniProt

Q9BYE7

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human PCGF6

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TQPLYNISANEGTGHFKPLEKKFVRVSGEATIGHVEKFLRRKMGLDPACQ

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

30kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_115530

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ELISA Kit For Coiled-coil domain-containing protein 83
E15762m 96 Tests

ELISA Kit For Coiled-coil domain-containing protein 83

Sign In for Pricing
View Details
Lentiviral human ANKRD17 shRNA (UAS) - Lentiviral human ANKRD17 shRNA (UAS, GFP) (25)
GTR15306815 1 Vial

Lentiviral human ANKRD17 shRNA (UAS) - Lentiviral human ANKRD17 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
CCL18 (C-C Motif Chemokine 18, Alternative Macrophage Activation-associated CC Chemokine 1, AMAC-1, CC Chemokine PARC, Dendritic Cell Chemokine 1, DC-CK1, Macrophage Inflammatory Protein 4, MIP-4, Pulmonary and Activation-regulated Chemokine, Small-induci
MBS6372545-01 0.1 mL

CCL18 (C-C Motif Chemokine 18, Alternative Macrophage Activation-associated CC Chemokine 1, AMAC-1, CC Chemokine PARC, Dendritic Cell Chemokine 1, DC-CK1, Macrophage Inflammatory Protein 4, MIP-4, Pulmonary and Activation-regulated Chemokine, Small-induci

Sign In for Pricing
View Details
CCL18 (C-C Motif Chemokine 18, Alternative Macrophage Activation-associated CC Chemokine 1, AMAC-1, CC Chemokine PARC, Dendritic Cell Chemokine 1, DC-CK1, Macrophage Inflammatory Protein 4, MIP-4, Pulmonary and Activation-regulated Chemokine, Small-induci
MBS6372545-02 5x 0.1 mL

CCL18 (C-C Motif Chemokine 18, Alternative Macrophage Activation-associated CC Chemokine 1, AMAC-1, CC Chemokine PARC, Dendritic Cell Chemokine 1, DC-CK1, Macrophage Inflammatory Protein 4, MIP-4, Pulmonary and Activation-regulated Chemokine, Small-induci

Sign In for Pricing
View Details
RLBP1 Antibody
orb680884 100 µL

RLBP1 Antibody

Sign In for Pricing
View Details
Mono(4-carboxybutyl) Phthalate-d4
TRC-M525322-2.5MG 2.5 mg

Mono(4-carboxybutyl) Phthalate-d4

Sign In for Pricing
View Details