Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRIM54 Rabbit Polyclonal Antibody (Biotin)

TRIM54 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

MURF, RNF30, muRF3, MURF-3

UniProt

Q9BYV2

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human TRIM54

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: IYKQESSRPLHSKAEQHLMCEEHEEEKINIYCLSCEVPTCSLCKVFGAHK

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

45kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_115935

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

APEX2 Protein Vector (Human) (pPB-His-GST)
PV322707 500 ng

APEX2 Protein Vector (Human) (pPB-His-GST)

Sign In for Pricing
View Details
Human Glutamate decarboxylase 2 (GAD2) ELISA Kit
MBS7213703-01 48 Well

Human Glutamate decarboxylase 2 (GAD2) ELISA Kit

Sign In for Pricing
View Details
Human Glutamate decarboxylase 2 (GAD2) ELISA Kit
MBS7213703-02 96 Well

Human Glutamate decarboxylase 2 (GAD2) ELISA Kit

Sign In for Pricing
View Details
Human Glutamate decarboxylase 2 (GAD2) ELISA Kit
MBS7213703-03 5x 96 Well

Human Glutamate decarboxylase 2 (GAD2) ELISA Kit

Sign In for Pricing
View Details
Human Glutamate decarboxylase 2 (GAD2) ELISA Kit
MBS7213703-04 10x 96 Well

Human Glutamate decarboxylase 2 (GAD2) ELISA Kit

Sign In for Pricing
View Details
Anti-Human FURIN Nanobody (SAA1180)
HY484013-01 50 µg

Anti-Human FURIN Nanobody (SAA1180)

Sign In for Pricing
View Details