Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRIM55 Rabbit Polyclonal Antibody (HRP)

TRIM55 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

RNF29, muRF2, MURF-2

UniProt

B3KRC0

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human TRIM55

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SGGRFRCPSCRHEVVLDRHGVYGLQRNLLVENIIDIYKQESTRPEKKSDQ

Field of Research

Musculoskeletal & Connective Tissue Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

51kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_908974

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PROCR Mouse Monoclonal Antibody [Clone ID: OTI13E1]
CF805579 100 µg

PROCR Mouse Monoclonal Antibody [Clone ID: OTI13E1]

Sign In for Pricing
View Details
Human C8orf45 (MCMDC2) activation kit by CRISPRa
GA115934 1 Kit

Human C8orf45 (MCMDC2) activation kit by CRISPRa

Sign In for Pricing
View Details
Human Flt3L (FMS Like Tyrosine Kinase 3 Ligand) CLIA Kit
E-CL-H0075-01 24 Tests

Human Flt3L (FMS Like Tyrosine Kinase 3 Ligand) CLIA Kit

Sign In for Pricing
View Details
Human Flt3L (FMS Like Tyrosine Kinase 3 Ligand) CLIA Kit
E-CL-H0075-02 48 Tests

Human Flt3L (FMS Like Tyrosine Kinase 3 Ligand) CLIA Kit

Sign In for Pricing
View Details
Human Flt3L (FMS Like Tyrosine Kinase 3 Ligand) CLIA Kit
E-CL-H0075-03 96 Tests

Human Flt3L (FMS Like Tyrosine Kinase 3 Ligand) CLIA Kit

Sign In for Pricing
View Details
HBV Polyclonal Purified Antibody, Colloidal Gold Labeled,  10nm
GM-603-10 1 mL

HBV Polyclonal Purified Antibody, Colloidal Gold Labeled, 10nm

Sign In for Pricing
View Details