Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRIM55 Rabbit Polyclonal Antibody (HRP)

TRIM55 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

RNF29, muRF2, MURF-2

UniProt

Q9BYV6

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human TRIM55

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SGGRFRCPSCRHEVVLDRHGVYGLQRNLLVENIIDIYKQESTRPEKKSDQ

Field of Research

Musculoskeletal & Connective Tissue Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

60kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_908973

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MPR delta Antibody / PAQR6
RQ7868 100 µg

MPR delta Antibody / PAQR6

Sign In for Pricing
View Details
Lentiviral mouse Nr2e1 shRNA (UAS) - Lentiviral mouse Nr2e1 shRNA (UAS, iRFP) plasmid
GTR15226996 1 Vial

Lentiviral mouse Nr2e1 shRNA (UAS) - Lentiviral mouse Nr2e1 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Plectin Rabbit pAb, BF647 conjugated
orb3001286 100 µL

Plectin Rabbit pAb, BF647 conjugated

Sign In for Pricing
View Details
Sodium Hydroxide 0.02 mol/L (0.02N) Solution (0.2N)
2424A 00500 500 mL

Sodium Hydroxide 0.02 mol/L (0.02N) Solution (0.2N)

Sign In for Pricing
View Details
Acetyl-ACTH (7-24) (human, bovine, rat)
T76646-01 5 mg

Acetyl-ACTH (7-24) (human, bovine, rat)

Sign In for Pricing
View Details
Acetyl-ACTH (7-24) (human, bovine, rat)
T76646-02 50 mg

Acetyl-ACTH (7-24) (human, bovine, rat)

Sign In for Pricing
View Details