Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRIM55 Rabbit Polyclonal Antibody (HRP)

TRIM55 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

RNF29, muRF2, MURF-2

UniProt

Q9BYV6

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human TRIM55

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SGGRFRCPSCRHEVVLDRHGVYGLQRNLLVENIIDIYKQESTRPEKKSDQ

Field of Research

Musculoskeletal & Connective Tissue Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

60kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_908973

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-(Hydroxyimino)-3-oxo-pentanedioic Acid 1,5-Diethyl Ester
TRC-H943315-25MG 25 mg

2-(Hydroxyimino)-3-oxo-pentanedioic Acid 1,5-Diethyl Ester

Sign In for Pricing
View Details
Alkbh3 Mouse Gene Knockout Kit (CRISPR)
KN501147 1 Kit

Alkbh3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Vmn2r88 Mouse Gene Knockout Kit (CRISPR)
KN519220 1 Kit

Vmn2r88 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
KLH Rabbit Polyclonal Antibody
R1307-6 100 µL

KLH Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Thrombin Receptor (F2R) Rabbit Polyclonal Antibody
TA376059 100 µL

Thrombin Receptor (F2R) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SA 4503 Dihydrochloride
TRC-S139590-50MG 50 mg

SA 4503 Dihydrochloride

Sign In for Pricing
View Details