Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NSMCE1 Rabbit Polyclonal Antibody (HRP)

NSMCE1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

NSE1

UniProt

Q8WV22

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human NSMCE1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RPIYALVNLATTSISKMATDFAENELDLFRKALELIIDSETGFASSTNIL

Field of Research

Epigenetics & Chromatin

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_659547

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EIF4EBP2 (NM_004096) Human Recombinant Protein
TP720559XL 1 mg

EIF4EBP2 (NM_004096) Human Recombinant Protein

Sign In for Pricing
View Details
beta III TubULin (TUBB3) Human Gene Knockout Kit (CRISPR)
KN400755 1 Kit

beta III TubULin (TUBB3) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
OSBPL10 Polyclonal Antibody
E-AB-66023-01 60 µL

OSBPL10 Polyclonal Antibody

Sign In for Pricing
View Details
OSBPL10 Polyclonal Antibody
E-AB-66023-02 120 µL

OSBPL10 Polyclonal Antibody

Sign In for Pricing
View Details
OSBPL10 Polyclonal Antibody
E-AB-66023-03 200 µL

OSBPL10 Polyclonal Antibody

Sign In for Pricing
View Details
Angiotensin I Converting Enzyme (ACE) / CD143 (9B9), CF740 conjugate, 0.1mg/mL
BNC741560-100 1x 100 µL

Angiotensin I Converting Enzyme (ACE) / CD143 (9B9), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details