Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Trim11 Rabbit Polyclonal Antibody (HRP)

Trim11 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q99PQ2

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GSFYNSNEPAFSPLRDPPKRVGIFLDYEAGHLSFYSATDGSLLFIFPETL

Field of Research

Infectious Disease & Virology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

52kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_444398

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZC3H14 (NM_207662) Human Over-expression Lysate
LC403936 20 µg

ZC3H14 (NM_207662) Human Over-expression Lysate

Sign In for Pricing
View Details
Human PATE (PATE1) activation kit by CRISPRa
GA115994 1 Kit

Human PATE (PATE1) activation kit by CRISPRa

Sign In for Pricing
View Details
MAEA Human Gene Knockout Kit (CRISPR)
KN400147 1 Kit

MAEA Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SLC17A3 (NM_001098486) Human Over-expression Lysate
LC420591 20 µg

SLC17A3 (NM_001098486) Human Over-expression Lysate

Sign In for Pricing
View Details
Fthl17a Mouse Gene Knockout Kit (CRISPR)
KN500048 1 Kit

Fthl17a Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ITM2C (NM_030926) Human Over-expression Lysate
LY403097 100 µg

ITM2C (NM_030926) Human Over-expression Lysate

Sign In for Pricing
View Details