Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Trim11 Rabbit Polyclonal Antibody (HRP)

Trim11 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q99PQ2

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GSFYNSNEPAFSPLRDPPKRVGIFLDYEAGHLSFYSATDGSLLFIFPETL

Field of Research

Infectious Disease & Virology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

52kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_444398

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ANKRD34A (NM_001039888) Human Recombinant Protein
TP313340M 100 µg

ANKRD34A (NM_001039888) Human Recombinant Protein

Sign In for Pricing
View Details
Human TPRA1 activation kit by CRISPRa
GA115152 1 Kit

Human TPRA1 activation kit by CRISPRa

Sign In for Pricing
View Details
ART3 Antibody
KC-22191-01 50 μL

ART3 Antibody

Sign In for Pricing
View Details
ART3 Antibody
KC-22191-02 100 µL

ART3 Antibody

Sign In for Pricing
View Details
ART3 Antibody
KC-22191-03 1 mL

ART3 Antibody

Sign In for Pricing
View Details
Dual Apoptosis Assay with NucView® 488 caspase-3 Substrate and Texas Red-Annexin V (50 - 250 assays)
#30030 1 Kit

Dual Apoptosis Assay with NucView® 488 caspase-3 Substrate and Texas Red-Annexin V (50 - 250 assays)

Sign In for Pricing
View Details