Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RNF185 Rabbit Polyclonal Antibody (Biotin)

RNF185 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

FLJ38628

UniProt

Q96GF1

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human RNF185

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: QVCPVCKAGISRDKVIPLYGRGSTGQQDPREKTPPRPQGQRPEPENRGGF

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

20kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_689480

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Kjeldahl Reagent 3.3% w/v Boric Acid Sol - 10L
BOA3310 10 L

Kjeldahl Reagent 3.3% w/v Boric Acid Sol - 10L

Sign In for Pricing
View Details
SIRT2 Rabbit Polyclonal Antibody (Cy7)
orb2441028 100 µL

SIRT2 Rabbit Polyclonal Antibody (Cy7)

Sign In for Pricing
View Details
SLC19A2 siRNA (Human)
orb1861077-01 15 nmol

SLC19A2 siRNA (Human)

Sign In for Pricing
View Details
SLC19A2 siRNA (Human)
orb1861077-02 30 nmol

SLC19A2 siRNA (Human)

Sign In for Pricing
View Details
Interleukin 1 Receptor Type II (IL-1RII, IL1R2, IL-1R2, IL-1R-2, IL-1RT2, IL-1RT-2, CD121 Antigen-like Family Member B, CD121b, CDw121B, Interleukin-1 Receptor beta, IL-1R beta, IL-1R-beta, IL1RB, IL1-Rb, MGC47725)(APC)
MBS6507793-01 100 Tests

Interleukin 1 Receptor Type II (IL-1RII, IL1R2, IL-1R2, IL-1R-2, IL-1RT2, IL-1RT-2, CD121 Antigen-like Family Member B, CD121b, CDw121B, Interleukin-1 Receptor beta, IL-1R beta, IL-1R-beta, IL1RB, IL1-Rb, MGC47725)(APC)

Sign In for Pricing
View Details
Interleukin 1 Receptor Type II (IL-1RII, IL1R2, IL-1R2, IL-1R-2, IL-1RT2, IL-1RT-2, CD121 Antigen-like Family Member B, CD121b, CDw121B, Interleukin-1 Receptor beta, IL-1R beta, IL-1R-beta, IL1RB, IL1-Rb, MGC47725)(APC)
MBS6507793-02 5x 100 Tests

Interleukin 1 Receptor Type II (IL-1RII, IL1R2, IL-1R2, IL-1R-2, IL-1RT2, IL-1RT-2, CD121 Antigen-like Family Member B, CD121b, CDw121B, Interleukin-1 Receptor beta, IL-1R beta, IL-1R-beta, IL1RB, IL1-Rb, MGC47725)(APC)

Sign In for Pricing
View Details