Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RNF217 Rabbit Polyclonal Antibody (HRP)

RNF217 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

OSTL, IBRDC1, C6orf172, dJ84N20.1

UniProt

Q8TC41

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human RNF217

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: IKYKYFLELGRIDSSTKPCPQCKHFTTFKKKGHIPTPSRSESKYKIQCPT

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

30kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_689766

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse SORT1 shRNA Plasmid
abx972820-01 150 µg

Mouse SORT1 shRNA Plasmid

Sign In for Pricing
View Details
Mouse SORT1 shRNA Plasmid
abx972820-02 300 µg

Mouse SORT1 shRNA Plasmid

Sign In for Pricing
View Details
FCGR2B Recombinant Protein (Human)
RP011995 100 µg

FCGR2B Recombinant Protein (Human)

Sign In for Pricing
View Details
Rabbit Polyclonal SZRD1 Antibody [DyLight 594]
NBP2-99181DL594 0.1 mL

Rabbit Polyclonal SZRD1 Antibody [DyLight 594]

Sign In for Pricing
View Details
Fam100a 3'UTR Luciferase Stable Cell Line
TU204221 1.0 mL

Fam100a 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Aggrecan (AGC)
MBS2109177-01 0.1 mL

HRP-Linked Polyclonal Antibody to Aggrecan (AGC)

Sign In for Pricing
View Details