Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RNF217 Rabbit Polyclonal Antibody (FITC)

RNF217 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

OSTL, IBRDC1, C6orf172, dJ84N20.1

UniProt

Q8TC41

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human RNF217

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: GLALGAIAVVIVEEIKTYWNLISGRTRNQTQHLAPQPVLLSDMLYCLKQV

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

32kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Yeast

Tested Applications

WB

NCBI Accession Number

NP_689766

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NUCB2 Rabbit Polyclonal Antibody (PerCP)
orb2446872 100 µL

NUCB2 Rabbit Polyclonal Antibody (PerCP)

Sign In for Pricing
View Details
N-terminal procollagen IV propeptide (PIVNP) Human ELISA Kit
F2392 96 Tests

N-terminal procollagen IV propeptide (PIVNP) Human ELISA Kit

Sign In for Pricing
View Details
Lentiviral human PPP1CC sgRNA gene knockout kit - Lentiviral human PPP1CC sgRNA gene knockout kit (100)
GTR15357697 1 Vial

Lentiviral human PPP1CC sgRNA gene knockout kit - Lentiviral human PPP1CC sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
Axygen 1000uL MultiRack Extended Pipette Tip Reload 768/pack 4 pack/case
PIP1056 3072 / PCK

Axygen 1000uL MultiRack Extended Pipette Tip Reload 768/pack 4 pack/case

Sign In for Pricing
View Details
PSG2 (Pregnancy Specific beta-1-Glycoprotein 2, CEA, PSBG2, PSG1, PSGGB)
250563 50 µL

PSG2 (Pregnancy Specific beta-1-Glycoprotein 2, CEA, PSBG2, PSG1, PSGGB)

Sign In for Pricing
View Details
Rabbit GANP Antibody
orb1525412-01 10 µL

Rabbit GANP Antibody

Sign In for Pricing
View Details