Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MARCH10 Rabbit Polyclonal Antibody (FITC)

MARCH10 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Rnf190, MARCH-X, March10, RGD1311692

UniProt

Q5XIV2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: QRFAELMTLNYRRASRERMSRNYPQPRPEESESSESGDGNESNVYPGRVI

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

86kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001013995

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Oven Advanced Security Model 180L Mechanical Convection
OVE2172 1 Each

Oven Advanced Security Model 180L Mechanical Convection

Sign In for Pricing
View Details
Human FNIP2 Knockout HEK293T cell line
GTR15418352 1 Vial

Human FNIP2 Knockout HEK293T cell line

Sign In for Pricing
View Details
CDK4 (Cyclin-Dependent Kinase 4, CMM3, MGC14458, PSK-J3)
244522 100 µg

CDK4 (Cyclin-Dependent Kinase 4, CMM3, MGC14458, PSK-J3)

Sign In for Pricing
View Details
NEGR1 Rabbit Polyclonal Antibody (HRP)
orb482110 100 µL

NEGR1 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
SH2D4A Rabbit Polyclonal Antibody (Cy3)
orb2591467 100 µg

SH2D4A Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details
CLAC-P, NC2-1 Region (CLACP, Collagen-like Alzheimer Amyloid Plaque Component, CLAC-P NC2-1) (PE)
301330-PE 100 µL

CLAC-P, NC2-1 Region (CLACP, Collagen-like Alzheimer Amyloid Plaque Component, CLAC-P NC2-1) (PE)

Sign In for Pricing
View Details