Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRIM42 Rabbit Polyclonal Antibody (FITC)

TRIM42 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

T4A1, PPP1R40

UniProt

Q8IWZ5

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human TRIM42

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: VKTPGPIVIYQTLVYPRAAKVYWTCPAEDVDSFEMEFYEVITSPPNNVQM

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

80kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_689829

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P4HB Rabbit Polyclonal Antibody (PE-Cy5.5)
orb911085 100 µL

P4HB Rabbit Polyclonal Antibody (PE-Cy5.5)

Sign In for Pricing
View Details
Rat Mullerian Inhibiting Substance/Anti Mullerian Hormone ELISA Kit
MBS725379-01 48 Well

Rat Mullerian Inhibiting Substance/Anti Mullerian Hormone ELISA Kit

Sign In for Pricing
View Details
Rat Mullerian Inhibiting Substance/Anti Mullerian Hormone ELISA Kit
MBS725379-02 96 Well

Rat Mullerian Inhibiting Substance/Anti Mullerian Hormone ELISA Kit

Sign In for Pricing
View Details
Rat Mullerian Inhibiting Substance/Anti Mullerian Hormone ELISA Kit
MBS725379-03 5x 96 Well

Rat Mullerian Inhibiting Substance/Anti Mullerian Hormone ELISA Kit

Sign In for Pricing
View Details
Rat Mullerian Inhibiting Substance/Anti Mullerian Hormone ELISA Kit
MBS725379-04 10x 96 Well

Rat Mullerian Inhibiting Substance/Anti Mullerian Hormone ELISA Kit

Sign In for Pricing
View Details
DNAJC19 Antibody Blocking peptide
orb1447872 500 µg

DNAJC19 Antibody Blocking peptide

Sign In for Pricing
View Details