Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RNF182 Rabbit Polyclonal Antibody (FITC)

RNF182 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

FLJ40772, MGC33993

UniProt

Q8N6D2

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human RNF182

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LSSTPVVEFYRPASFDSVTTVSHNWTVWNCTSLLFQTSIRVLVWLLGLLY

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

27kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_689950

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C5orf47 sgRNA CRISPR Lentivector (Human) (Target 2)
K0241703 1.0 µg DNA

C5orf47 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Recombinant Encephalitozoon cuniculi Probable myosin havy chain ECU04_1000 (ECU04_1000), partial
MBS1375267 Inquire

Recombinant Encephalitozoon cuniculi Probable myosin havy chain ECU04_1000 (ECU04_1000), partial

Sign In for Pricing
View Details
Mgat4b Rat shRNA Plasmid (Locus ID 303100)
TL708407 1 Kit

Mgat4b Rat shRNA Plasmid (Locus ID 303100)

Sign In for Pricing
View Details
Recombinant Exiguobacterium sp. DNA-directed RNA polymerase subunit beta (rpoB), partial
MBS1220934 Inquire

Recombinant Exiguobacterium sp. DNA-directed RNA polymerase subunit beta (rpoB), partial

Sign In for Pricing
View Details
IQGAP3 (NM_178229) Human Over-expression Lysate
LY405981 100 µg

IQGAP3 (NM_178229) Human Over-expression Lysate

Sign In for Pricing
View Details
PRPSAP2 (NM_002767) Human Tagged Lenti ORF Clone
RC210719L4 10 µg

PRPSAP2 (NM_002767) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details