Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBR3 Rabbit Polyclonal Antibody (FITC)

UBR3 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

ZNF650

UniProt

Q6ZT12

Immunogen

The immunogen is a synthetic peptide directed towards the following sequence HSQNCGAGTGIFLLINASVIIIIRGHRFCLWGSVYLDAHGEEDRDLRRGK

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: HSQNCGAGTGIFLLINASVIIIIRGHRFCLWGSVYLDAHGEEDRDLRRGK

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

212 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

NCBI Accession Number

NP_742067

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD68 (Macrophage Marker) (C68/2908R), CF647 conjugate, 0.1mg/mL
BNC472908-500 1x 500 µL

CD68 (Macrophage Marker) (C68/2908R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mouse Elp6 activation kit by CRISPRa
GA209209 1 Kit

Mouse Elp6 activation kit by CRISPRa

Sign In for Pricing
View Details
RPL21 (NM_000982) Human Over-expression Lysate
LC424412 20 µg

RPL21 (NM_000982) Human Over-expression Lysate

Sign In for Pricing
View Details
Frozen Tissue Sections, Urinary bladder
CS648416 5x 5 µm

Frozen Tissue Sections, Urinary bladder

Sign In for Pricing
View Details
alpha smooth muscle Actin (ACTA2) (NM_001613) Human Over-expression Lysate
LC400608 20 µg

alpha smooth muscle Actin (ACTA2) (NM_001613) Human Over-expression Lysate

Sign In for Pricing
View Details
Aspartate beta hydroxylase (ASPH) (NM_032468) Human Recombinant Protein
TP323930M 100 µg

Aspartate beta hydroxylase (ASPH) (NM_032468) Human Recombinant Protein

Sign In for Pricing
View Details