Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBR3 Rabbit Polyclonal Antibody (HRP)

UBR3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ZNF650

UniProt

Q6ZT12

Immunogen

The immunogen is a synthetic peptide directed towards the following sequence HSQNCGAGTGIFLLINASVIIIIRGHRFCLWGSVYLDAHGEEDRDLRRGK

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: HSQNCGAGTGIFLLINASVIIIIRGHRFCLWGSVYLDAHGEEDRDLRRGK

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

212 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

NCBI Accession Number

NP_742067

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD10 (CB-CALLA), 0.2mg/mL
BNUB0146-100 1x 100 µL

CD10 (CB-CALLA), 0.2mg/mL

Sign In for Pricing
View Details
PON2 Rabbit Monoclonal Antibody [Clone ID: R05-1J3]
TA385008 100 µL

PON2 Rabbit Monoclonal Antibody [Clone ID: R05-1J3]

Sign In for Pricing
View Details
(+)-(S)-Dihydrokavain
TRC-D450620-1MG 1 mg

(+)-(S)-Dihydrokavain

Sign In for Pricing
View Details
Human ZNF449 activation kit by CRISPRa
GA116449 1 Kit

Human ZNF449 activation kit by CRISPRa

Sign In for Pricing
View Details
FCRL4 Human Gene Knockout Kit (CRISPR)
KN416335 1 Kit

FCRL4 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Aquaporin 2 (AQP2) (NM_000486) Human Over-expression Lysate
LY424696 100 µg

Aquaporin 2 (AQP2) (NM_000486) Human Over-expression Lysate

Sign In for Pricing
View Details