Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dtx3 Rabbit Polyclonal Antibody (HRP)

Dtx3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Mg310, Deltex3

UniProt

Q80V91

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: YEKYGTIVIQYVFPPGVQGAEHPNPGVRYPGTTRVAYLPDCPEGNKVLTL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_109639

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HDAC7 Protein Vector (Human) (pPB-C-His)
PV019345 500 ng

HDAC7 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Lentiviral human CDH19 shRNA (UAS) - Lentiviral human CDH19 shRNA (UAS) plasmid
GTR15140467 1 Vial

Lentiviral human CDH19 shRNA (UAS) - Lentiviral human CDH19 shRNA (UAS) plasmid

Sign In for Pricing
View Details
CD33 mAb, RBITC conjugated
orb3163703 100 µL

CD33 mAb, RBITC conjugated

Sign In for Pricing
View Details
Connexin 30.3 Rabbit Polyclonal Antibody (APC-Cy5.5)
orb2519448 100 µL

Connexin 30.3 Rabbit Polyclonal Antibody (APC-Cy5.5)

Sign In for Pricing
View Details
ZNF350, ID (ZNF350, ZBRK1, Zinc finger protein 350, KRAB zinc finger protein ZFQR, Zinc finger and BRCA1-interacting protein with a KRAB domain 1, Zinc finger protein ZBRK1) (PE)
MBS6366348-01 0.2 mL

ZNF350, ID (ZNF350, ZBRK1, Zinc finger protein 350, KRAB zinc finger protein ZFQR, Zinc finger and BRCA1-interacting protein with a KRAB domain 1, Zinc finger protein ZBRK1) (PE)

Sign In for Pricing
View Details
ZNF350, ID (ZNF350, ZBRK1, Zinc finger protein 350, KRAB zinc finger protein ZFQR, Zinc finger and BRCA1-interacting protein with a KRAB domain 1, Zinc finger protein ZBRK1) (PE)
MBS6366348-02 5x 0.2 mL

ZNF350, ID (ZNF350, ZBRK1, Zinc finger protein 350, KRAB zinc finger protein ZFQR, Zinc finger and BRCA1-interacting protein with a KRAB domain 1, Zinc finger protein ZBRK1) (PE)

Sign In for Pricing
View Details