Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRIML1 Rabbit Polyclonal Antibody (HRP)

TRIML1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

RNF209

UniProt

Q8N9V2

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human TRIML1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DSVSRKGNLPKPPGDLFSLIGLKIGDDYSLWVSSPLKGQHVREPVCKVGV

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

53kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_848651

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal Muscle Phosphofructokinase/PFKM/PFK-1 Antibody
NBP1-87293-25ul 25 µL

Rabbit Polyclonal Muscle Phosphofructokinase/PFKM/PFK-1 Antibody

Sign In for Pricing
View Details
Anti-Plastin L Rabbit Monoclonal Antibody, Carrier-free
M03361-2-carrier-free 100 µL

Anti-Plastin L Rabbit Monoclonal Antibody, Carrier-free

Sign In for Pricing
View Details
Adducin beta 2 Blocking Peptide
33R-9887 0.1 mg

Adducin beta 2 Blocking Peptide

Sign In for Pricing
View Details
PE-Cy5.5 Anti-Mouse CD80 Antibody (16-10A1)
PC55-30024-01 50 Tests

PE-Cy5.5 Anti-Mouse CD80 Antibody (16-10A1)

Sign In for Pricing
View Details
PE-Cy5.5 Anti-Mouse CD80 Antibody (16-10A1)
PC55-30024-02 100 Tests

PE-Cy5.5 Anti-Mouse CD80 Antibody (16-10A1)

Sign In for Pricing
View Details
Lentiviral human MAPK9 sgRNA gene knockout kit - Lentiviral human MAPK9 sgRNA gene knockout kit (100)
GTR15391237 1 Vial

Lentiviral human MAPK9 sgRNA gene knockout kit - Lentiviral human MAPK9 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details